PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0005800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 277aa    MW: 30303.1 Da    PI: 9.505
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0005800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.74.2e-113177347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      WT eE +++ +a + +  +   +W ++a++++ g+t+ +++ ++q +
  Spipo23G0005800 31 QWTHEENKQFENALAVFDERtpdRWQKVASMIP-GKTADDVRRHYQVL 77
                     6********************************.************75 PP

2Myb_DNA-binding49.31.2e-15130174347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+++++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  Spipo23G0005800 130 PWTEEEHKKFLMGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 174
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.6432779IPR017884SANT domain
SMARTSM007179.1E-92880IPR001005SANT/Myb domain
PfamPF002492.6E-93177IPR001005SANT/Myb domain
SuperFamilySSF466892.3E-123185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-63175IPR009057Homeodomain-like
CDDcd001674.79E-83277No hitNo description
PROSITE profilePS5129419.66123179IPR017930Myb domain
SuperFamilySSF466894.81E-18124179IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-17126177IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.1E-13127173IPR009057Homeodomain-like
SMARTSM007172.1E-13127177IPR001005SANT/Myb domain
PfamPF002494.4E-13130174IPR001005SANT/Myb domain
CDDcd001671.02E-11130175No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MWSGMEILSP AAACLPTSSL FTARTRGAAV QWTHEENKQF ENALAVFDER TPDRWQKVAS  60
MIPGKTADDV RRHYQVLEND VSHIEAGLFP PPGYGSPQFT MEGLKQPFVV AGGKRTGGRP  120
VDQERKKGVP WTEEEHKKFL MGLKKYGKGD WRNISRNFVT TRTPTQVASH AQKYFIRLSS  180
GGKDKRRSSI HDITTVNMSE TAAGAGTPPP QTPVPAVASE ASGIYNPPTA APPNPFDDGR  240
PSYDISAYGV KFQAQSSLPE ISSGPWGEQA LPFQMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1923108287RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3621844e-54AK362184.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2003C15.
GenBankAK3631924e-54AK363192.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013G01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008785420.14e-95PREDICTED: transcription factor DIVARICATA isoform X1
RefseqXP_008785419.14e-95PREDICTED: transcription factor DIVARICATA isoform X1
SwissprotQ8S9H76e-86DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0B0MSI12e-94A0A0B0MSI1_G
STRINGVIT_06s0004g06100.t012e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.15e-86MYB family protein